PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G304400.1
Common NamePHAVU_002G304400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 221aa    MW: 24487.7 Da    PI: 9.5464
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G304400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-1494138347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  Phvul.002G304400.1  94 PWTEEEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 138
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.1E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.52787143IPR017930Myb domain
SuperFamilySSF466896.32E-1888143IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-1890141IPR006447Myb domain, plants
SMARTSM007173.5E-1191141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-1291137IPR009057Homeodomain-like
CDDcd001673.04E-1094139No hitNo description
PfamPF002497.0E-1294138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRKCSHCGV IGHNSRTCTS LRGSSFVGLR LFGVQLDTCV TIKKSFSMDS LPSSSSSSFS  60
SSRLTIDENS DRTSFGYLSD GLIPPLQERK KGVPWTEEEH RIFLVGLEKL GKGDWRGISR  120
NFVTTRTPTQ VASHAQKYFL RLATIDKKKR RSSLFDVVGS NSPSIGVSSK CEVKNNDATL  180
SLLTYFQQET KSDYNKQENL DNCPHQPPNL DLTLRSCLLV *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146150KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311941e-166KT031194.1 Glycine max clone HN_CCL_90 MYB/HD-like transcription factor (Glyma08g03330.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160238.11e-162hypothetical protein PHAVU_002G304400g
TrEMBLV7CPV91e-162V7CPV9_PHAVU; Uncharacterized protein
STRINGGLYMA05G36290.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-52MYB_related family protein